. .
.
Pairwise Sequence Alignment using BLAST
.
.

 

Assignment

 

  1.  Given a protein sequence, find out which protein it is and from which organism it belongs using BLAST Program.

 

Protein Sequence

 

MERGVRRGAALVAAWRSLWERGGLALFRPQCRTGCGACRVQGTRPFSLSAAASAVLGLGSWGGDSGKQKLTLQDVAELIRKKECRRVVVMAGAGIS

TPSGIPDFRSPGSGLYSNLEQYNIPYPEAIFELAYFFINPKPFFTLAKELYPGNYRPNYAHYFLRLLHDKGLLLRLYTQNIDGLERVAGIPPDRLVEAHGT

FATATCTVCRRKFPGEDFRGDVMADKVPHCRVCTGIVKPDIVFFGEELPQRFFLHMTDFPMADLLFVIGTSLEVEPFASLAGAVRNSVPRVLINRDLV

GPFAWQQRYNDIAQLGDVVTGVEKMVELLDWNEEMQTLIQKEKEKLDAKDK

 

From the given details, find

 

  • What is the length of the query sequence ?
  • What is the number of sequences in the database searched ?
  • What is the E-value ? 

 

 

 

 

  1. Given a nucleotide sequence, find the details regarding the sequence like which organism, name, accession id etc. using BLAST 

 

Nucleotide Sequence :

 

AGTGCCGCGCGTCGAGCGGAGCAGAGGAGGCGAGGGCGGAGGGCCAGAGAGGCAGTTGGAAGATGGCGGACGAGGTGGCGCTCGCCCTTC

AGGCCGCCGGCTCCCCTTCCGCGGCGGCCGCCATGGAGGCCGCGTCGCAGCCGGCGGACGAGCCGCTCCGCAAGAGGCCCCGCCGAGA

CGGGCCTGGCCTCGGGCGCAGCCCGGGCGAGCCGAGCGCAGCAGTGGCGCCGGCGGCCGCGGGGTGTGAGGCGGCGAGCGCCGCGGC

CCCGGCGGCGCTGTGGCGGGAGGCGGCAGGGGCGGCGGCGAGCGCGGAGCGGGAGGCCCCGGCGACGGCCGTGGCCGGGGACGGAGA

CAATGGGTCCGGCCTGCGGCGGGAGCCGAGGGCGGCTGACGACTTCGACGACGACGAGGGCGAGGAGGAGGACGAGGCGGCGGCGGCAG

CGGCGGCGGCAGCGATCGGCTACCGAGACAACCTCCTGTTGACCGATGGACTCCTCACTAATGGCTTTCATTCCTGTGAAAGTGATGACGATG

ACAGAACGTCACACGCCAGCTCTAGTGACTGGACTCCGCGGCCGCGGATAGGTCCATATACTTTTGTTCAGCAACATCTCATGATTGGCACCG

ATCCTCGAACAATTCTTAAAGATTTATTACCAGAAACAATTCCTCCACCTGAGCTGGATGATATGACGCTGTGGCAGATTGTTATTAATATCCTTTC

AGAACCACCAAAGCGGAAAAAAAGAAAAGATATCAATACAATTGAAGATGCTGTGAAGTTACTGCAGGAGTGTAAAAAGATAATAGTTCTGACTGGA

GCTGGGGTTTCTGTCTCCTGTGGGATTCCTGACTTCAGATCAAGAGACGGTATCTATGCTCGCCTTGCGGTGGACTTCCCAGACCTCCCAGA

CCCTCAAGCCATGTTTGATATTGAGTATTTTAGAAAAGACCCAAGACCATTCTTCAAGTTTGCAAAGGAAATATATCCCGGACAGTTCCAGCCGT

CTCTGTGTCACAAATTCATAGCTTTGTCAGATAAGGAAGGAAAACTACTTCGAAATTATACTCAAAATATAGATACCTTGGAGCAGGTTGCAGGAAT

CCAAAGGATCCTTCAGTGTCATGGTTCCTTTGCAACAGCATCTTGCCTGATTTGTAAATACAAAGTTGATTGTGAAGCTGTTCGTGGAGACATTTTT

AATCAGGTAGTTCCTCGGTGCCCTAGGTGCCCAGCTGATGAGCCACTTGCCATCATGAAGCCAGAGATTGTCTTCTTTGGTGAAAACTTACCAG

AACAGTTTCATAGAGCCATGAAGTATGACAAAGATGAAGTTGACCTCCTCATTGTTATTGGATCTTCTCTGAAAGTGAGACCAGTAGCACTAATTCC

AAGTTCTATACCCCATGAAGTGCCTCAAATATTAATAAATAGGGAACCTTTGCCTCATCTACATTTTGATGTAGAGCTCCTTGGAGACTGCGATGTT

ATAATTAATGAGTTGTGTCATAGGCTAGGTGGTGAATATGCCAAACTTTGTTGTAACCCTGTAAAGCTTTCAGAAATTACTGAAAAACCTCCACGCC

CACAAAAGGAATTGGTTCATTTATCAGAGTTGCCACCAACACCTCTTCATATTTCGGAAGACTCAAGTTCACCTGAAAGAACTGTACCACAAGACT

CTTCTGTGATTGCTACACTTGTAGACCAAGCAACAAACAACAATGTTAATGATTTAGAAGTATCTGAATCAAGTTGTGTGGAAGAAAAACCACAAGAA

GTACAGACTAGTAGGAATGTTGAGAACATTAATGTGGAAAATCCAGATTTTAAGGCTGTTGGTTCCAGTACTGCAGACAAAAATGAAAGAACTTCAGT

TGCAGAAACAGTGAGAAAATGCTGGCCTAATAGACTTGCAAAGGAGCAGATTAGTAAGCGGCTTGAGGGTAATCAATACCTGTTTGTACCACCAAA

TCGTTACATATTCCACGGTGCTGAGGTATACTCAGACTCTGAAGATGACGTCTTGTCCTCTAGTTCCTGTGGCAGTAACAGTGACAGTGGCACAT

GCCAGAGTCCAAGTTTAGAAGAACCCTTGGAAGATGAAAGTGAAATTGAAGAATTCTACAATGGCTTGGAAGATGATACGGAGAGGCCCGAATGTG

CTGGAGGATCTGGATTTGGAGCTGATGGAGGGGATCAAGAGGTTGTTAATGAAGCTATAGCTACAAGACAGGAATTGACAGATGTAAACTATCCAT

CAGACAAATCATAACACTATTGAAGCTGTCCGGATTCAGGAATTGCTCCACCAGCATTGGGAACTTTAGCATGTCAAAAAATGAATGTTTACTTGTG

AACTTGAACAAGGAAATCTGAAAGATGTATTATTTATAGACTGGAAAATAGATTGTCTTCTTGGATAATTTCTAAAGTTCCATCATTTCTGTTTGTACTT

GTACATTCAACACTGTTGGTTGACTTCATCTTCCTTTCAAGGTTCATTTGTATGATACATTCGTATGTATGTATAATTTTGTTTTTTGCCTAATGAGTT

TCAACCTTTTAAAGTTTTCAAAAGCCATTGGAATGTTAATGTAAAGGGAACAGCTTATCTAGACCAAAGAATGGTATTTCACACTTTTTTGTTTGTAAC

ATTGAATAGTTTAAAGCCCTCAATTTCTGTTCTGCTGAACTTTTATTTTTAGGACAGTTAACTTTTTAAACACTGGCATTTTCCAAAACTTGTGGCAGC

TAACTTTTTAAAATCACAGATGACTTGTAATGTGAGGAGTCAGCACCGTGTCTGGAGCACTCAAAACTTGGTGCTCAGTGTGTGAAGCGTACTTAC

TGCATCGTTTTTGTACTTGCTGCAGACGTGGTAATGTCCAAACAGGCCCCTGAGACTAATCTGATAAATGATTTGGAAATGTGTTTCAGTTGTTCTA

GAAACAATAGTGCCTGTCTATATAGGTCCCCTTAGTTTGAATATTTGCCATTGTTTAATTAAATACCTATCACTGTGGTAGAGCCTGCATAGATCTTC

ACCACAAATACTGCCAAGATGTGAATATGCAAAGCCTTTCTGAATCTAATAATGGTACTTCTACTGGGGAGAGTGTAATATTTTGGACTGCTGTTTTT

CCATTAATGAGGAAAGCAATAGGCCTCTTAATTAAAGTCCCAAAGTCATAAGATAAATTGTAGCTCAACCAGAAAGTACACTGTTGCCTGTTGAGGAT

TTGGTGTAATGTATCCCAAGGTGTTAGCCTTGTATTATGGAGATGAATACAGATCCAATAGTCAAATGAAACTAGTTCTTAGTTATTTAAAAGCTTAGC

TTGCCTTAAAACTAGGGATCAATTTTCTCAACTGCAGAAACTTTTAGCCTTTCAAACAGTTCACACCTCAGAAAGTCAGTATTTATTTTACAGACTTC

TTTGGAACATTGCCCCCAAATTTAAATATTCATGTGGGTTTAGTATTTATTACAAAAAAATGATTTGAAATATAGCTGTTCTTTATGCATAAAATACCCA

GTTAGGACCATTACTGCCAGAGGAGAAAAGTATTAAGTAGCTCATTTCCCTACCTAAAAGATAACTGAATTTATTTGGCTACACTAAAGAATGCAGTA

TATTTAGTTTTCCATTTGCATGATGTGTTTGTGCTATAGACAATATTTTAAATTGAAAAATTTGTTTTAAATTATTTTTACAGTGAAGACTGTTTTCAGCT

CTTTTTATATTGTACATAGACTTTTATGTAATCTGGCATATGTTTTGTAGACCGTTTAATGACTGGATTATCTTCCTCCAACTTTTGAAATACAAAAACA

GTGTTTTATACTTGTATCTTGTTTTAAAGTCTTATATTAAAATTGTCATTTGACTTTTTTCCCGTTAAAAAAAAAAAAAAA

 


 

 

Cite this Simulator:

.....
..... .....

Copyright @ 2020 Under the NME ICT initiative of MHRD

 Powered by AmritaVirtual Lab Collaborative Platform [ Ver 00.13. ]